PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017413m
Common NameCARUB_v10017413mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 392aa    MW: 44831.2 Da    PI: 5.5261
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017413mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.34.8e-2968152286
         trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      W ++e+++Li +r em++ ++++k++k+lWee+s+kmre+gf rsp +C++kw+n+ k++kk k+++ k ts+ s +++y+++++
  Carubv10017413m  68 WVQDETRTLISLRGEMDNLFNTSKSNKHLWEEISNKMREKGFDRSPAMCTDKWRNILKEFKKAKHQDDKATSGGSAKMSYYKEID 152
                      ***********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.43260124IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.1E-461126IPR009057Homeodomain-like
SMARTSM007172.1E-464126IPR001005SANT/Myb domain
CDDcd122031.15E-2966131No hitNo description
PfamPF138377.4E-2167154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
FEYLTFVSLS SSSSVRENMF VSDNNPSRDI NMMIDLPTQQ QNHQIILGDS SGGEDHEIKA  60
PKKRAETWVQ DETRTLISLR GEMDNLFNTS KSNKHLWEEI SNKMREKGFD RSPAMCTDKW  120
RNILKEFKKA KHQDDKATSG GSAKMSYYKE IDDIFRERNK KVALYKSPAT PPSSAKVDSF  180
MQFTDKGFED TGISFTSVEA NGRPSLNLET QLDHDGLPLA MASADPVTAN GVPPWNWRDP  240
SGNGGDVHPF VGRIITVKFG EYTRRFGIDG TAEAIKEAIR SAFRLRTRRA FWLEDEEQVV  300
RSLDRDMPLG NYTLHVDEGI AVRVCHYDES DPLPVHQEEK IFYTEEDYKD FLARRGWTCL  360
REFDAFRNID VVRNIDNMDD LQPGVLYRGM R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-4362150186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00003PBMTransfer from 484361Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0723700.0AB072370.1 Arabidopsis thaliana mRNA for transcription factor GT-4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291280.10.0hypothetical protein CARUB_v10017413mg, partial
SwissprotQ9LU920.0TGT4_ARATH; Trihelix transcription factor GT-4
TrEMBLR0HJX10.0R0HJX1_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G25990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25990.10.0Trihelix family protein